AibGenesis™ Mouse Anti-SCOC Antibody (CBMOAB-57255FYA)


Cat: CBMOAB-57255FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-57255FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO57255FYA 100 µg
MO-AB-19812R Monoclonal Cattle (Bos taurus) WB, ELISA MO19812R 100 µg
MO-AB-28871H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28871C 100 µg
MO-AB-63962W Monoclonal Marmoset WB, ELISA MO63962W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus)
CloneMO57255FYA
SpecificityThis antibody binds to Rhesus SCOC.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a short coiled-coiled domain-containing protein that localizes to the Golgi apparatus. The encoded protein interacts with ADP-ribosylation factor-like proteins. Pseudogenes of this gene are found on chromosomes 1 and 14. Alternative splicing results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Rhesus SCOC Antibody is a mouse antibody against SCOC. It can be used for SCOC detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSCOC
UniProt IDF6ZBU2
Protein RefseqThe length of the protein is 100 amino acids long.
The sequence is show below: VDHSSRILYPRHKSLLPKMMNADMDAVDAENQVELEEKTRLINQVLELQHTLEDLSARVDAVKEENLKLKSENQVLGQYIENLMSASSVFQTTDTKSKRK.
For Research Use Only | Not For Clinical Use.
Online Inquiry