AibGenesis™ Mouse Anti-SCRT2 Antibody (CBMOAB-57270FYA)


Cat: CBMOAB-57270FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-57270FYA Monoclonal Rhesus (Macaca mulatta), Chicken (Gallus gallus), Zebrafish (Danio rerio) WB, ELISA MO57270FYA 100 µg
CBMOAB-97335FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO97335FYA 100 µg
MO-AB-03912Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO03912Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chicken (Gallus gallus), Zebrafish (Danio rerio)
CloneMO57270FYA
SpecificityThis antibody binds to Rhesus SCRT2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus SCRT2 Antibody is a mouse antibody against SCRT2. It can be used for SCRT2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSCRT2
UniProt IDF7H9B0
Protein RefseqThe length of the protein is 307 amino acids long.
The sequence is show below: MPRSFLVKKIKGDGFQCSGVPAPTYHPLETAYVLPGARGPPGDNGYAPHCLPPSSYDADQKPGLELAPAEPAYPPAAPEEYSDPESPQSSLSARYFRGEAAVTDSYSMDAFFISDGRSRRRRGGGGGDAGGSGDAGGTGGRAGRAGAQAGGGHRHACAECGKTYATSSNLSRHKQTHRSLDSQLARKCPTCGKAYVSMPALAMHVLTHNLRHKCGVCGKAFSRPWLLQGHMRSHTGEKPFGCAHCGKAFADRSNLRAHMQTHSAFKHYRCRQCDKSFALKSYLHKHCEAACVKGAEPPPPTPAGPAS.
For Research Use Only | Not For Clinical Use.
Online Inquiry