AibGenesis™ Mouse Anti-SDHAF4 Antibody (MO-AB-05833W)


Cat: MO-AB-05833W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-05833W Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO05833W 100 µg
MO-AB-25544W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO25544W 100 µg
MO-AB-28889H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28889C 100 µg
MO-AB-63991W Monoclonal Marmoset WB, ELISA MO63991W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO05833W
SpecificityThis antibody binds to Rhesus SDHAF4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus SDHAF4 Antibody is a mouse antibody against SDHAF4. It can be used for SDHAF4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSuccinate Dehydrogenase Complex Assembly Factor 4; SDH Assembly Factor 4; C6orf57; Succinate Dehydrogenase Assembly Factor 4, Mitochondrial; Chromosome 6 Open Reading Frame 57; UPF0369 Protein C6orf57; Sdh8
UniProt IDF6TGS4
Protein RefseqThe length of the protein is 237 amino acids long.
The sequence is show below: MATRSCREKAQKLNEQHQLILSKLLREEDNKYCADCEAKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWTAEQIQCMQDMGNTKARLLYEANLPENFRRPQTDQAVEFFIRDKYEKKKYYDKNAIAITNKEKEKKKEEKRREKEPEKPAKPLTTEKLQKKEEQQLEPKKSTSPKKAAEPTVDLLGLDGPAVAPVTNGNTTVPPLNDDLDIFGPMISNPLPATGMPPAQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry