AibGenesis™ Mouse Anti-SERINC4 Antibody (CBMOAB-57464FYA)


Cat: CBMOAB-57464FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-57464FYA Monoclonal Rhesus (Macaca mulatta), Marmoset, Rabbit (Oryctolagus cuniculus) WB, ELISA MO57464FYA 100 µg
MO-AB-09878Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO09878Y 100 µg
MO-AB-64138W Monoclonal Marmoset WB, ELISA MO64138W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset, Rabbit (Oryctolagus cuniculus)
CloneMO57464FYA
SpecificityThis antibody binds to Rhesus SERINC4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus SERINC4 Antibody is a mouse antibody against SERINC4. It can be used for SERINC4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSERINC4
UniProt IDF7G919
Protein RefseqThe length of the protein is 270 amino acids long.
The sequence is show below: QHGITLASVEALHSSYCSWCLLQLLPIPGTRTEQPRSGLLQASVISCYIMYLTFSALSSRPPERVILQGQNHTLCLPGLSKMEPQTPDTSLAMLSAGIMYACVLFACNEASYLAEVFGPLWIVKVYRYEFQKPSLCFCCPEIVEADEGQRGGAARPADQETPPAPSVQVQHLSYNYSAFHFVFFLASLYVMVTLTNWFSYEGAELEKTFIKGSWATFWVKVASCWACVLLYLGLLLAPLCRSPTQKPQPLLLRRRRHHRIISPDNKYPPV.
For Research Use Only | Not For Clinical Use.
Online Inquiry