AibGenesis™ Mouse Anti-SERP2 Antibody (CBMOAB-57466FYA)
Cat: CBMOAB-57466FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-57466FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, ELISA | MO57466FYA | 100 µg | ||
| CBMOAB-97721FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO97721FYA | 100 µg | ||
| MO-AB-19964R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO19964R | 100 µg | ||
| MO-AB-28927H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO28927C | 100 µg | ||
| MO-AB-64141W | Monoclonal | Marmoset | WB, ELISA | MO64141W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) |
| Clone | MO57466FYA |
| Specificity | This antibody binds to Rhesus SERP2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Cytoskeleton; Endoplasmic reticulum; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Rhesus SERP2 Antibody is a mouse antibody against SERP2. It can be used for SERP2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | SERP2 |
| UniProt ID | F7A226 |
| Protein Refseq | The length of the protein is 80 amino acids long. The sequence is show below: MVAKQRIRMANEKHSKNITQRGNVAKTLVRRGRRVPVGPWRLEFAIFAGQPHKLAFPGDCQNFLKTVTSRGSHPHPGPAS. |
For Research Use Only | Not For Clinical Use.
Online Inquiry