AibGenesis™ Mouse Anti-SERTAD4 Antibody (CBMOAB-57502FYA)


Cat: CBMOAB-57502FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-57502FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO57502FYA 100 µg
MO-AB-25466W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO25466W 100 µg
MO-AB-64174W Monoclonal Marmoset WB, ELISA MO64174W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset
CloneMO57502FYA
SpecificityThis antibody binds to Rhesus SERTAD4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionSERTAD4 (SERTA Domain Containing 4) is a Protein Coding gene.
Product OverviewMouse Anti-Rhesus SERTAD4 Antibody is a mouse antibody against SERTAD4. It can be used for SERTAD4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSERTA domain-containing protein 4; SERTAD4
UniProt IDH9F700
Protein RefseqThe length of the protein is 116 amino acids long.
The sequence is show below: SHQVDFDVGSAPVYKSDGQIPANEIFVTNVRSLGVQEKAKLNEEKANNDTNRDGGPLSHEPVGNDLAFECKGQFYDYFETGYNERNNVNESWKKSLRKKEASPPSNKLCCSKGSKI.
For Research Use Only | Not For Clinical Use.
Online Inquiry