Mouse Anti-SFRP2 Antibody (CBMOAB-57569FYA)
Cat: CBMOAB-57569FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-57569FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Mallard (Anas platyrhynchos), Marmoset, Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, ELISA | MO57569FYA | 100 µg | ||
| CBMOAB-97900FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO97900FYA | 100 µg | ||
| MO-AB-20115W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO20115W | 100 µg | ||
| MO-AB-33303W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO33303W | 100 µg | ||
| MO-AB-64247W | Monoclonal | Marmoset | WB, ELISA | MO64247W | 100 µg | ||
| MO-AB-20035R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO20035R | 100 µg | ||
| MO-AB-07574H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO07574C | 100 µg | ||
| MO-AB-23709H | Monoclonal | Mallard (Anas platyrhynchos) | WB, ELISA | MO23709C | 100 µg | ||
| MO-AB-28943H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO28943C | 100 µg | ||
| MO-AB-03945Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO03945Y | 100 µg | ||
| MO-AB-17602Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO17602Y | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Mallard (Anas platyrhynchos), Marmoset, Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) |
| Clone | MO57569FYA |
| Specificity | This antibody binds to Rhesus SFRP2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Extracellular region or secreted |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. SFRPs act as soluble modulators of Wnt signaling. Methylation of this gene is a potential marker for the presence of colorectal cancer. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus SFRP2 Antibody is a mouse antibody against SFRP2. It can be used for SFRP2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | SFRP2 |
| UniProt ID | F7C8E8 |
| Protein Refseq | The length of the protein is 247 amino acids long. The sequence is show below: XLCHGIEYQNMRLPNLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIMETLCKNDFALKIKVKEITYINRDTKIILETKSKTIYKLNGVSERDLKKSVLWLKDSLQCTCEEMNDINAPYLVMGQKQGGELVITSVKRWQKGQREFKRISRSIRKLQC. |
For Research Use Only | Not For Clinical Use.
Online Inquiry