AibGenesis™ Mouse Anti-SFRS12IP1 Antibody (CBMOAB-57571FYA)


Cat: CBMOAB-57571FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-57571FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO57571FYA 100 µg
MO-AB-20039R Monoclonal Cattle (Bos taurus) WB, ELISA MO20039R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO57571FYA
SpecificityThis antibody binds to Rhesus SFRS12IP1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus SFRS12IP1 Antibody is a mouse antibody against SFRS12IP1. It can be used for SFRS12IP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein SREK1IP1; SFRS12IP1
UniProt IDH9F1B5
Protein RefseqThe length of the protein is 78 amino acids long.
The sequence is show below: MAVPGCNKDSVRAGCKKCGYPGHLTFECRNFLRVDPKRDIVLDVSSTSSEDSDEENEELNKLQALQEKRINEEEEKKK.
For Research Use Only | Not For Clinical Use.
Online Inquiry