AibGenesis™ Mouse Anti-SH3GL3 Antibody (CBMOAB-57663FYA)


Cat: CBMOAB-57663FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-57663FYA Monoclonal Rhesus (Macaca mulatta), Chicken (Gallus gallus), Frog (Xenopus laevis) WB, ELISA MO57663FYA 100 µg
MO-AB-03949Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO03949Y 100 µg
MO-AB-07608H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07608C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chicken (Gallus gallus), Frog (Xenopus laevis)
CloneMO57663FYA
SpecificityThis antibody binds to Rhesus SH3GL3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus SH3GL3 Antibody is a mouse antibody against SH3GL3. It can be used for SH3GL3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesEndophilin-A3; SH3GL3
UniProt IDH9F7S0
Protein RefseqThe length of the protein is 307 amino acids long.
The sequence is show below: DVTNKAVAEILSKTTEYLQPNPAYRAKLGMLNTVSKIRGQVKATGYPQTEGLLGDCMLKYGKELGEDSTFGNALIEVGESMKLMAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLKKLEGRRLDYDYKKKRVGKIPDEEVRQAVEKFEESKELAERSMFNFLENDVEQVSQLAVFIEAALDYHKQSTEILQELQSKLQMRISAASSVPRREYKPRPVKRSASELNGVSTTSVVKTTGSNIPMDQPCCRGLYDFEPENQGELGFKEGDIITLTNQIDENWYEGMIHGESGFFPINYVEVIVPLPQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry