AibGenesis™ Mouse Anti-SH3TC1 Antibody (CBMOAB-57683FYA)


Cat: CBMOAB-57683FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-57683FYA Monoclonal Rhesus (Macaca mulatta), Frog (Xenopus laevis), Zebrafish (Danio rerio) WB, ELISA MO57683FYA 100 µg
CBMOAB-98069FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO98069FYA 100 µg
MO-AB-07614H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07614C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Frog (Xenopus laevis), Zebrafish (Danio rerio)
CloneMO57683FYA
SpecificityThis antibody binds to Rhesus SH3TC1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus SH3TC1 Antibody is a mouse antibody against SH3TC1. It can be used for SH3TC1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSH3 domain and tetratricopeptide repeats-containing protein 1; SH3TC1
UniProt IDH9FDE3
Protein RefseqThe length of the protein is 109 amino acids long.
The sequence is show below: PPCLGLEPQETLPKVKNVLEQCKTCPGCPQEPASWGLCVASSNVSLQDPEEPSFCLEAEDDWEDPEALSSLLLFLNAPGYKASFRGLYDVALPWLSSVFCSFSDEEELT.
For Research Use Only | Not For Clinical Use.
Online Inquiry