AibGenesis™ Mouse Anti-SHROOM2 Antibody (CBMOAB-57740FYA)


Cat: CBMOAB-57740FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-57740FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset WB, ELISA MO57740FYA 100 µg
MO-AB-05978W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO05978W 100 µg
MO-AB-20116R Monoclonal Cattle (Bos taurus) WB, ELISA MO20116R 100 µg
MO-AB-64375W Monoclonal Marmoset WB, ELISA MO64375W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset
CloneMO57740FYA
SpecificityThis antibody binds to Rhesus SHROOM2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus SHROOM2 Antibody is a mouse antibody against SHROOM2. It can be used for SHROOM2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein Shroom2; SHROOM2
UniProt IDH9FE52
Protein RefseqThe length of the protein is 273 amino acids long.
The sequence is show below: FTLKGGREHGEPLVITKIEEGSKAAAVDKLLAGDEIVGINDIGLSGFRQEAICLVKGSHKTLKLVVKRRSELGWRPHSWHATKFSDSHPELAASPFPSASSCPSWSGRHHASSSSHDLSSSWEQTNLQRTLDHFSSLGSVGSLDHPSSRLSVAKSNSSIDHLGSHSKRDSAYGSFSTSSSTPDHTLSKADTSSAENILYSVGLWEAPRQGGRQAQAAGDPQGLEEKLRCFPPRVPSDSDKGPRPEYNAEPKLAVPGRSNFGPVWYVPDKKKAP.
For Research Use Only | Not For Clinical Use.
Online Inquiry