Mouse Anti-SLC25A15 Antibody (CBMOAB-58030FYA)


Cat: CBMOAB-58030FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-58030FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO58030FYA 100 µg
MO-AB-19512W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19512W 100 µg
MO-AB-20282R Monoclonal Cattle (Bos taurus) WB, ELISA MO20282R 100 µg
MO-AB-64538W Monoclonal Marmoset WB, ELISA MO64538W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO58030FYA
SpecificityThis antibody binds to Rhesus SLC25A15.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a member of the mitochondrial carrier family. The encoded protein transports ornithine across the inner mitochondrial membrane from the cytosol to the mitochondrial matrix. The protein is an essential component of the urea cycle, and functions in ammonium detoxification and biosynthesis of the amino acid arginine. Mutations in this gene result in hyperornithinemia-hyperammonemia-homocitrullinuria (HHH) syndrome. There is a pseudogene of this locus on the Y chromosome. (From NCBI)
Product OverviewMouse Anti-Rhesus SLC25A15 Antibody is a mouse antibody against SLC25A15. It can be used for SLC25A15 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSLC25A15
UniProt IDF6ZEC3
Protein RefseqThe length of the protein is 301 amino acids long.
The sequence is show below: MKSNPAIQAAIDLTAGAAGGTACVLTGQPFDTMKVKMQTFPDLYRGLTDCCLKTYSQVGFRGFYKGTSPALIANIAENSVLFMCYGFCQQVVRKVAGLDKQAKLSDLQNAAAGSFASAFAALVLCPTELVKCRLQTMYEMETSGKIAKSQNTVWSVIKSILRKDGPLGFYHGLSSTLLREVPGYFFFFGGYELSRSFFASGRSKDELGPVPLMLSGGVGGICLWLAVYPVDCIKSRIQVLSMSGKQAGFMRTFINVVKNEGITALYSGLKPTMIRAFPANGALFLAYEYSRKLMMNQLEAY.
For Research Use Only | Not For Clinical Use.
Online Inquiry