Mouse Anti-SLC25A38 Antibody (CBMOAB-58066FYA)


Cat: CBMOAB-58066FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-58066FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Hamsters (Cricetinae), Marmoset, O. mykiss (Oncorhynchus mykiss), Sheep (Ovis aries) WB, ELISA MO58066FYA 100 µg
MO-AB-13259Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO13259Y 100 µg
MO-AB-17660Y Monoclonal Sheep (Ovis aries) WB, ELISA MO17660Y 100 µg
MO-AB-18867W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18867W 100 µg
MO-AB-20307R Monoclonal Cattle (Bos taurus) WB, ELISA MO20307R 100 µg
MO-AB-43435W Monoclonal Hamsters (Cricetinae) WB, ELISA MO43435W 100 µg
MO-AB-64564W Monoclonal Marmoset WB, ELISA MO64564W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Hamsters (Cricetinae), Marmoset, O. mykiss (Oncorhynchus mykiss), Sheep (Ovis aries)
CloneMO58066FYA
SpecificityThis antibody binds to Rhesus SLC25A38.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a member of the mitochondrial carrier family. The encoded protein is required during erythropoiesis and is important for the biosynthesis of heme. Mutations in this gene are the cause of autosomal congenital sideroblastic anemia (anemia, sideroblastic, 2, pyridoxine-refractory). A related pseudogene is found on chromosome 1. (From NCBI)
Product OverviewMouse Anti-Rhesus SLC25A38 Antibody is a mouse antibody against SLC25A38. It can be used for SLC25A38 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSLC25A38
UniProt IDF6U6E7
Protein RefseqThe length of the protein is 212 amino acids long.
The sequence is show below: SIVRCVPGVGIYFGTLYSLKQYFLRGHPPTALESIMLGVGSRSVAGVCMSPITVIKTRYESGKYGYESIYAALRSIYRSEGHRGLFSGLTATLLRDAPFSGIYLMFYNQTKNIVPHDQVDATLIPITNFSCGIFAGILASLVTQPADVIKTHMQLYPLKFQWIGQAVTLIFKDYGLRGFFQGGIPRALRRTLMAAMAWTVYEEMMAKMGLKS.
For Research Use Only | Not For Clinical Use.
Online Inquiry