AibGenesis™ Mouse Anti-SLC35A3 Antibody (CBMOAB-58165FYA)


Cat: CBMOAB-58165FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-58165FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Dog (Canis lupus familiaris), Hamsters (Cricetinae), Pig (Sus scrofa) WB, ELISA MO58165FYA 100 µg
MO-AB-20382R Monoclonal Cattle (Bos taurus) WB, ELISA MO20382R 100 µg
MO-AB-30137R Monoclonal Pig (Sus scrofa) WB, ELISA MO30137R 100 µg
MO-AB-33377W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO33377W 100 µg
MO-AB-43439W Monoclonal Hamsters (Cricetinae) WB, ELISA MO43439W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Dog (Canis lupus familiaris), Hamsters (Cricetinae), Pig (Sus scrofa)
CloneMO58165FYA
SpecificityThis antibody binds to Rhesus SLC35A3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a UDP-N-acetylglucosamine transporter found in the golgi apparatus membrane. In cattle, a missense mutation in this gene causes complex vertebral malformation. Alternative splicing results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Rhesus SLC35A3 Antibody is a mouse antibody against SLC35A3. It can be used for SLC35A3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSLC35A3
UniProt IDF6R6U5
Protein RefseqThe length of the protein is 367 amino acids long.
The sequence is show below: MSSHSVLSPVVDTDAPDQHLELKKPQELKEMERLPLVNEDKTMSANLKYLSLGILVFQTTSLVLTMRYSRTLKEEGPRYLSSTAVVVAELLKIMACILLVYKDSKCSLRALNRVLHDEILNKPMETLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTALFSVSMLSKKLGVYQWLSLVILMTGVAFVQWPSDSQLDSKELSAGSQFVGLMAVLTACFSSGFAGVYFEKILKETKQSVWIRNIQLGFFGSIFGLMGVYIYDGELVSKNGFFQGYNRLTWIVVVLQALGGLVIAAVIKYADNILKGFATSLSIILSTLISYFWLQDFVPTSVFFLGAILVITATFLYGYDPKPAGNPTKA.
For Research Use Only | Not For Clinical Use.
Online Inquiry