Mouse Anti-SP5 Antibody (CBMOAB-58810FYA)


Cat: CBMOAB-58810FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-58810FYA Monoclonal Rhesus (Macaca mulatta), Frog (Xenopus laevis), Marmoset WB, ELISA MO58810FYA 100 µg
MO-AB-07955H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07955C 100 µg
MO-AB-65143W Monoclonal Marmoset WB, ELISA MO65143W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Frog (Xenopus laevis), Marmoset
CloneMO58810FYA
SpecificityThis antibody binds to Rhesus SP5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus SP5 Antibody is a mouse antibody against SP5. It can be used for SP5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSP5
UniProt IDF7HPZ3
Protein RefseqThe length of the protein is 398 amino acids long.
The sequence is show below: MAAVAVLRNDSLQAFLQDRTPSASPDLGKHSPLALLAATCSRIGQPGATAPPDFLQVPYDPALGSPSRLFHPWTADMPAHSPGALPPPHPSLGLTPQKTHLQPSFGAAHELPLTPPADPSYPYEFSPVKMLPSSMAALPASCAPAYVPYAAQAALPPGYSNLLPPPPPPPPPPTCRQLSPNPAPDDLPWWSIPQAGAGPGASGVPGSSLSGACAGAPHAPRFPASAAAAAAAAAALQRGLVLGPSDFAQYQSQIAALLQTKAPLAATARRCRRCRCPNCQAAGGAPEAEPGKKKQHVCHVPGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKSFTRSDELQRHLRTHTGEKRFACPECGKRFMRSDHLAKHVKTHQNKKLKVAEAGVKREDPRDL.
For Research Use Only | Not For Clinical Use.
Online Inquiry