AibGenesis™ Mouse Anti-SPATA3 Antibody (CBMOAB-58869FYA)


Cat: CBMOAB-58869FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-58869FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Pig (Sus scrofa), Rat (Rattus norvegicus) WB, ELISA MO58869FYA 100 µg
MO-AB-20783R Monoclonal Cattle (Bos taurus) WB, ELISA MO20783R 100 µg
MO-AB-29138H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29138C 100 µg
MO-AB-30378R Monoclonal Pig (Sus scrofa) WB, ELISA MO30378R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Pig (Sus scrofa), Rat (Rattus norvegicus)
CloneMO58869FYA
SpecificityThis antibody binds to Rhesus SPATA3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionSPATA3 (Spermatogenesis Associated 3) is a Protein Coding gene.
Product OverviewMouse Anti-Rhesus SPATA3 Antibody is a mouse antibody against SPATA3. It can be used for SPATA3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSPATA3
UniProt IDF7GZK1
Protein RefseqThe length of the protein is 192 amino acids long.
The sequence is show below: MKKVKKKRSEAKRHRDSTSQHASSNSTSQQPSPESTPQQPSPESTPQQPSPESTPQQSSLETNSQQPASQALPAPEIRRSSRCLLSPDANMKAAPQSRKAGPLTRAGPHSCSCATCPCSSACWRRLGLCHSRIFDVLLPRDWQMAPGRGLPNLLTFYRKPSRKPSSHRNTCPPSPRNCGCGSGGSRSCLLHH.
For Research Use Only | Not For Clinical Use.
Online Inquiry