AibGenesis™ Mouse Anti-SPATA33 Antibody (CBMOAB-58874FYA)


Cat: CBMOAB-58874FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-58874FYA Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus) WB, ELISA MO58874FYA 100 µg
MO-AB-29139H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29139C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus)
CloneMO58874FYA
SpecificityThis antibody binds to Rhesus SPATA33.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionSPATA33 (Spermatogenesis Associated 33) is a Protein Coding gene.
Product OverviewMouse Anti-Rhesus SPATA33 Antibody is a mouse antibody against SPATA33. It can be used for SPATA33 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSPATA33
UniProt IDF6TVY5
Protein RefseqThe length of the protein is 139 amino acids long.
The sequence is show below: MVTRAAAARTSCEEQKKESIYSVPKSKDKLMEKHSQETRQADRESEKPVDSLHPGSATAKHPSPAASQEEKPDVKQKSSRKKVVVPQIIITRASNETLTSGSSSGSDQQRTIREQEDWGPYWRHRNPSTVDAYSSHLKE.
For Research Use Only | Not For Clinical Use.
Online Inquiry