AibGenesis™ Mouse Anti-SPRY3 Antibody (CBMOAB-58989FYA)


Cat: CBMOAB-58989FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-58989FYA Monoclonal Rhesus (Macaca mulatta), Chicken (Gallus gallus), Marmoset WB, ELISA MO58989FYA 100 µg
MO-AB-04128Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO04128Y 100 µg
MO-AB-65257W Monoclonal Marmoset WB, ELISA MO65257W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chicken (Gallus gallus), Marmoset
CloneMO58989FYA
SpecificityThis antibody binds to Rhesus SPRY3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus SPRY3 Antibody is a mouse antibody against SPRY3. It can be used for SPRY3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein sprouty homolog 3; SPRY3
UniProt IDH9F0Y5
Protein RefseqThe length of the protein is 137 amino acids long.
The sequence is show below: MDAAVTDDFQQILPIEQLRSTHASNDYVERPPAPCKQALSSPSLIVQTHKSDWSLATMPTSLPRSLSQCHQLQPLPQHLSQSSIASSMSHSTTASDQRLLASITPSPSGQSIIRTQPGAGVHPKADGALKGEAEQSA.
For Research Use Only | Not For Clinical Use.
Online Inquiry