AibGenesis™ Mouse Anti-STAP2 Antibody (CBMOAB-59232FYA)


Cat: CBMOAB-59232FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-59232FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset WB, ELISA MO59232FYA 100 µg
MO-AB-06292W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO06292W 100 µg
MO-AB-20995R Monoclonal Cattle (Bos taurus) WB, ELISA MO20995R 100 µg
MO-AB-65462W Monoclonal Marmoset WB, ELISA MO65462W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset
CloneMO59232FYA
SpecificityThis antibody binds to Rhesus STAP2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus STAP2 Antibody is a mouse antibody against STAP2. It can be used for STAP2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSTAP2
UniProt IDH9H2N0
Protein RefseqThe length of the protein is 301 amino acids long.
The sequence is show below: QLRVPSNLTLLPGHLYMMAEVLAKEEARRALETPSWSQTPRLGSAPPERQVRKGQVWATGGDEDGASQWLDLLWGQSQCRTHVVRHYKVKREGPKYVIDVEQPDPSPICPQFSCTSLDAVVNYFVSHTKKALVPFLLDEDYEKVLGYVEADKENGESVWVAPSALGPGPAPCTGGPKPLPPASVPVSSQDKLPLLPPLPPLPNQEENYVTPIGDAPVVDYENQDVASSSRPVIVKPKKLPKPPAKLPKPSIGPKPEPRVFNGGLARKLPASSAQPLFPAAGLADMTAELQKKLEKRRALEH.
For Research Use Only | Not For Clinical Use.
Online Inquiry