AibGenesis™ Mouse Anti-SUMF1 Antibody (CBMOAB-59443FYA)


Cat: CBMOAB-59443FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-59443FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Marmoset WB, ELISA MO59443FYA 100 µg
MO-AB-06330W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO06330W 100 µg
MO-AB-10833W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10833W 100 µg
MO-AB-21134R Monoclonal Cattle (Bos taurus) WB, ELISA MO21134R 100 µg
MO-AB-35791W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35791W 100 µg
MO-AB-65656W Monoclonal Marmoset WB, ELISA MO65656W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Marmoset
CloneMO59443FYA
SpecificityThis antibody binds to Rhesus SUMF1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus SUMF1 Antibody is a mouse antibody against SUMF1. It can be used for SUMF1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSUMF1
UniProt IDF6R409
Protein RefseqThe length of the protein is 369 amino acids long.
The sequence is show below: MAAPALGLVCGRYPESGRVLLLLLLSLLCGAAGSEEAGTSAVAGSLAGSCGCGTPQRPGVHGSSGAAHRYSREANAPGSVPGERPLAHSKMVPIPAGVFTMGTDDPQIKQDGEAPARRVTIDAFYMDAYEVSNAEFEKFVNSTGYLTEAEKFGDSFVFEGMLSEQVKTNIQQAVAAAPWWLPVKGANWRHPEGPDSTIRHRMTNCSLRTSEQCSLFHCIPSLDFNPKPADAYVSSDRLFPWGNKLQPKGQHYANIWQGEFPVTNTGEDGFQGTAPVDAFPPNGYGLYNIVGNAWEWTSDWWTVHHSVEETLNPKGPPSGKDRVKKGGSYMCHRSYCYRYRCAARSQNTPDSSASNLGFRCAADRLPTMD.
For Research Use Only | Not For Clinical Use.
Online Inquiry