AibGenesis™ Mouse Anti-SYAP1 Antibody (CBMOAB-59523FYA)


Cat: CBMOAB-59523FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-59523FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), O. mykiss (Oncorhynchus mykiss) WB, ELISA MO59523FYA 100 µg
MO-AB-08204H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08204C 100 µg
MO-AB-13364Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO13364Y 100 µg
MO-AB-17251W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17251W 100 µg
MO-AB-21169R Monoclonal Cattle (Bos taurus) WB, ELISA MO21169R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), O. mykiss (Oncorhynchus mykiss)
CloneMO59523FYA
SpecificityThis antibody binds to Rhesus SYAP1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Golgi apparatus; Cytosol; Other locations; Plasma Membrane

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus SYAP1 Antibody is a mouse antibody against SYAP1. It can be used for SYAP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSYAP1
UniProt IDH9H428
Protein RefseqThe length of the protein is 296 amino acids long.
The sequence is show below: FTDYLFNFASAATKKITESVAETAQTIKKSVEEGKIDGIIDKTIIGDFQKEQKKFVEEQHTKKSEAAVPPWVDTNDEETIQQQILALSADKRNFLRDPPAGVQFNFDFDQMYPVALVMLQEDELLSKMRFALVPKLVKEEVFWRNYFYRVSLIKQSAQLTALAAQQQAAGKEEKSNGREQDLPLTEAVRPKTPPVVIKSQLKTQEDEEEISTSPGVSEFVSDAFDACNLNQEDLRKEMEQLVLDKKQEETAVLEEDSADWEKELQQELQEYEVVTESEKRDENWDKEIEKMLQEEN.
For Research Use Only | Not For Clinical Use.
Online Inquiry