AibGenesis™ Mouse Anti-SYCE2 Antibody (CBMOAB-59528FYA)


Cat: CBMOAB-59528FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-59528FYA Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus) WB, ELISA MO59528FYA 100 µg
MO-AB-29307H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29307C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus)
CloneMO59528FYA
SpecificityThis antibody binds to Rhesus SYCE2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus SYCE2 Antibody is a mouse antibody against SYCE2. It can be used for SYCE2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSYCE2
UniProt IDF6V1Z5
Protein RefseqThe length of the protein is 210 amino acids long.
The sequence is show below: DVPHVKCKDQEPQPLGESKEHQRWEENCKEEAGGGPASASCQLTVLEGKSGLYFSSLDSSIDILQKRAQELIENINESRQKDHALMTNFRNSLKTKVTDFTQREGGFLMQKGGNEPLMNEKLQEFTQKMAKISHLETELKQVCHSVETVYKDLCLQPESLRLRRGPDHSRGKSPPRPSDSQPPDVFVSSVAETTSQATASEEQTHRDGEC.
For Research Use Only | Not For Clinical Use.
Online Inquiry