AibGenesis™ Mouse Anti-TAS2R19 Antibody (CBMOAB-59743FYA)


Cat: CBMOAB-59743FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-59743FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes) WB, ELISA MO59743FYA 100 µg
MO-AB-26446W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26446W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes)
CloneMO59743FYA
SpecificityThis antibody binds to Rhesus TAS2R19.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus TAS2R19 Antibody is a mouse antibody against TAS2R19. It can be used for TAS2R19 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTaste receptor type 2; TAS2R19
UniProt IDF6Y4W7
Protein RefseqThe length of the protein is 269 amino acids long.
The sequence is show below: LGNFANGFIALVNVIDWVKTRKISLVDQILTALVIYRIGLLWAILLYWYATMFNSALCSSEVRIFASNISAIINHFSIWLAASLSIFYLLKIANFSNLIFLHLQKRIKSVVWVMLLGPLVFFICNLAVVTTDEGVWTKEYEGNVTWKIKLKNAIHLSNLTISTLANLIPFTLTLICFLLLIYSLCKHLKKIQLHGKGSQDLSTKVHIKSLQTVISFLMLFAIYFLCLISLTWSPWKQQNKLVFLLCQTLAIMYPSFHSFILIMGNRKLK.
For Research Use Only | Not For Clinical Use.
Online Inquiry