AibGenesis™ Mouse Anti-TCEB1 Antibody (MO-AB-06454W)


Cat: MO-AB-06454W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-06454W Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO06454W 100 µg
MO-AB-08179W Monoclonal Cat (Felis catus) WB, ELISA MO08179W 100 µg
MO-AB-14852W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14852W 100 µg
MO-AB-65973W Monoclonal Marmoset WB, ELISA MO65973W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO06454W
SpecificityThis antibody binds to Rhesus TCEB1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus TCEB1 Antibody is a mouse antibody against TCEB1. It can be used for TCEB1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTranscription elongation factor B polypeptide 1 isoform a; TCEB1
UniProt IDH9F3J1
Protein RefseqThe length of the protein is 102 amino acids long.
The sequence is show below: CEGPDAMYVRLISSDGHEFVVKTERALTSGMIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC.
For Research Use Only | Not For Clinical Use.
Online Inquiry