AibGenesis™ Mouse Anti-THAP5 Antibody (CBMOAB-60147FYA)


Cat: CBMOAB-60147FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-60147FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO60147FYA 100 µg
MO-AB-04409Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO04409Y 100 µg
MO-AB-06513W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO06513W 100 µg
MO-AB-21522R Monoclonal Cattle (Bos taurus) WB, ELISA MO21522R 100 µg
MO-AB-21843W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21843W 100 µg
MO-AB-66136W Monoclonal Marmoset WB, ELISA MO66136W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO60147FYA
SpecificityThis antibody binds to Rhesus THAP5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus THAP5 Antibody is a mouse antibody against THAP5. It can be used for THAP5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTHAP5
UniProt IDF7H729
Protein RefseqThe length of the protein is 231 amino acids long.
The sequence is show below: MLTVNLVKQHTGKPESTLETSVYQDTGIGDFHTCFEDLNSTTITLTTSNSESIHQSLETQDVLEVTTNHLANPNFTSNSMEIKSAQENPFLFSTINQTVEELNTSKESVIAIFVPAENSKPSVNSFISTQKETMEMEDIEDSLYKDVDYGTEVLQIEHSYCRQDINKEHLWQKVSKLHSKITLLELKEQQTLGRLKSLEALVRQLKQENWLSEENVKIIENHFTTYEVTMI.
For Research Use Only | Not For Clinical Use.
Online Inquiry