AibGenesis™ Mouse Anti-THAP6 Antibody (CBMOAB-60149FYA)


Cat: CBMOAB-60149FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-60149FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO60149FYA 100 µg
MO-AB-21524R Monoclonal Cattle (Bos taurus) WB, ELISA MO21524R 100 µg
MO-AB-26077W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26077W 100 µg
MO-AB-66137W Monoclonal Marmoset WB, ELISA MO66137W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO60149FYA
SpecificityThis antibody binds to Rhesus THAP6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus THAP6 Antibody is a mouse antibody against THAP6. It can be used for THAP6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTHAP domain-containing protein 6; THAP6
UniProt IDH9Z191
Protein RefseqThe length of the protein is 222 amino acids long.
The sequence is show below: MVKCCSAIGCASRCLPNSKLKGLTFHVFPTDENIKRKWVLAMKRLDVNAAGIWEPKKGDVLCSRHFKKTDFDRSAPNIKLKPGVIPSIFDSPYHLQGKREKLHCRKNFPLKPVPATNYNHHLVGAASCIKEFQSQFIFEHSYSVMDSPKKLKHKLDHVIGELEDTKESLRNVLDREKRFQKSLRKTIRELKDECLISQETANRLDAFCWECCQESIEQDYIA.
For Research Use Only | Not For Clinical Use.
Online Inquiry