AibGenesis™ Mouse Anti-THAP8 Antibody (CBMOAB-60153FYA)


Cat: CBMOAB-60153FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-60153FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO60153FYA 100 µg
MO-AB-21526R Monoclonal Cattle (Bos taurus) WB, ELISA MO21526R 100 µg
MO-AB-21599W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21599W 100 µg
MO-AB-66141W Monoclonal Marmoset WB, ELISA MO66141W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO60153FYA
SpecificityThis antibody binds to Rhesus THAP8.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus THAP8 Antibody is a mouse antibody against THAP8. It can be used for THAP8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTHAP domain-containing protein 8; THAP8
UniProt IDH9FCV0
Protein RefseqThe length of the protein is 114 amino acids long.
The sequence is show below: KSQQRTRRTQKPVSPPPPLQEKTPLPQGPAIPVSDPVRLVVLDPTSGSPETAATMLLTPLAPAATPEGSQPEVPAQQAQTGLGSVLGALQRRVQRLQRCQEQHQAQLQALERLA.
For Research Use Only | Not For Clinical Use.
Online Inquiry