AibGenesis™ Mouse Anti-THEM5 Antibody (CBMOAB-60168FYA)


Cat: CBMOAB-60168FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-60168FYA Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus) WB, ELISA MO60168FYA 100 µg
MO-AB-29444H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29444C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus)
CloneMO60168FYA
SpecificityThis antibody binds to Rhesus THEM5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus THEM5 Antibody is a mouse antibody against THEM5. It can be used for THEM5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTHEM5
UniProt IDF7DCZ2
Protein RefseqThe length of the protein is 156 amino acids long.
The sequence is show below: GLNLPSGLAVSSDKGDCRIFTRCIQVEGQGFEYVIFFQPSKKKSVCLFQPGPYLEGPPGFTHSGSLAAMMDETFSKTAFLAGEGVFTLSFNIRFKNLIPMSSLVVMDIEVGKIEDQKLYMSCIAHSRDQQTVYTKSSGKGAPSPAPGPVLPPPTPR.
For Research Use Only | Not For Clinical Use.
Online Inquiry