Mouse Anti-TIMM22 Antibody (CBMOAB-60250FYA)


Cat: CBMOAB-60250FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-60250FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO60250FYA 100 µg
MO-AB-10324W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10324W 100 µg
MO-AB-21588R Monoclonal Cattle (Bos taurus) WB, ELISA MO21588R 100 µg
MO-AB-29465H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29465C 100 µg
MO-AB-66203W Monoclonal Marmoset WB, ELISA MO66203W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO60250FYA
SpecificityThis antibody binds to Rhesus TIMM22.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus TIMM22 Antibody is a mouse antibody against TIMM22. It can be used for TIMM22 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMitochondrial import inner membrane translocase subunit Tim22; TIMM22
UniProt IDH9F3V3
Protein RefseqThe length of the protein is 193 amino acids long.
The sequence is show below: AAAASNAGASAPEAAGSAEAPLQYSLLLQYLVGDKRQPRLLEPGSLGGIPSPAKSEEQKMIEKVMESCAFKAALACVGGFVLGGAFGVFTAGIDTNVGFDPKDPYRTPTAKEVLKDMGQRGMSYAKNFAIVGAMFSCTECLVESYRGKSDWKNSVISGCITGGAIGFRAGLKAGAIGCGGFAAFSAAIDYYLR.
For Research Use Only | Not For Clinical Use.
Online Inquiry