AibGenesis™ Mouse Anti-TMEM125 Antibody (CBMOAB-60424FYA)


Cat: CBMOAB-60424FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-60424FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO60424FYA 100 µg
MO-AB-21770R Monoclonal Cattle (Bos taurus) WB, ELISA MO21770R 100 µg
MO-AB-29524H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29524C 100 µg
MO-AB-66359W Monoclonal Marmoset WB, ELISA MO66359W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus)
CloneMO60424FYA
SpecificityThis antibody binds to Rhesus TMEM125.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus TMEM125 Antibody is a mouse antibody against TMEM125. It can be used for TMEM125 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTransmembrane protein 125; TMEM125
UniProt IDH9FPW1
Protein RefseqThe length of the protein is 219 amino acids long.
The sequence is show below: MSEQEAQAPRGRGLPPDMLAEQVELWWSQQPRRSALCFVVAVGLVAGCGAGGVALLSTTSSRSGEWRLATGTVLCLLALLVLVKQLMSSAVQDMNCIRQAHHVALLRSGGGADALVVLLSGLVLLVTGLTLAGLAAAPAPARPLAAMLSVGIALAALGSLLLLGLLLYQVGVSGHCPSICMLTSSTHSGHGGHGSIFSISGQLSAGRRHETTSSIASLI.
For Research Use Only | Not For Clinical Use.
Online Inquiry