AibGenesis™ Mouse Anti-TMEM155 Antibody (CBMOAB-60477FYA)


Cat: CBMOAB-60477FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-60477FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes) WB, ELISA MO60477FYA 100 µg
MO-AB-13531W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13531W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes)
CloneMO60477FYA
SpecificityThis antibody binds to Rhesus TMEM155.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus TMEM155 Antibody is a mouse antibody against TMEM155. It can be used for TMEM155 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein TMEM155; TMEM155
UniProt IDH9F289
Protein RefseqThe length of the protein is 111 amino acids long.
The sequence is show below: TAVDAELMPSGVILQNKRENLPRVCHALAFLGMARCQDLFLVRLQGWKLGTRFQDGPCSCPQEGGGSPQRKRGMPVRIHLLFKSFLSRPIAFAFISLARTVSLATAIGKIV.
For Research Use Only | Not For Clinical Use.
Online Inquiry