Mouse Anti-TMEM175 Antibody (CBMOAB-60499FYA)


Cat: CBMOAB-60499FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-60499FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO60499FYA 100 µg
MO-AB-04510Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO04510Y 100 µg
MO-AB-21808R Monoclonal Cattle (Bos taurus) WB, ELISA MO21808R 100 µg
MO-AB-24389W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24389W 100 µg
MO-AB-66419W Monoclonal Marmoset WB, ELISA MO66419W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO60499FYA
SpecificityThis antibody binds to Rhesus TMEM175.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus TMEM175 Antibody is a mouse antibody against TMEM175. It can be used for TMEM175 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTransmembrane protein 175; TMEM175
UniProt IDI0FHH9
Protein RefseqThe length of the protein is 504 amino acids long.
The sequence is show below: MSQPQTPEQALDTLGDCLPGRRDEDAGEGIQCSQRMLNFSDALLSIIATVMILPVTHTEISPEQQFDRSVQRLLATRIAVYLMTFLIVTVAWAAHTRLFQVVGKTDDTLALLNLACMMTITFLPYTFSLMVTFPDVPLGIFLFCVCVITIGVVQALIVGYAFHFPHLLSPQIQCSVHRARYRQHVLGIVLQGPALCFAAAIFSLFFVPLSYLLMVTVILLPYVSKVTGWCRDRLLGHREPSAHPVEVFTFDLHEPLSKERVEAFSDGVYAIVATLLILDICEDNVPDPKEVKERFGGSLVAALSATGPRFLAYFGSFATVGLLWFAHHSLFLHVRKATRAMGLLNTLSLAFVGGLPLAYQQTSAFARQPRDELERVRVSCAIIFLASIFQFAIWTTALLHQAETLQPSVWFGGREHALMFAKLALYPCASLLAFTSTCLLSRFSVGIFHLMQIAVPCAFLLLRLLVGLALASLRVLHGIARPEHPPPAPTCQEDPQSQLLPAPC.
For Research Use Only | Not For Clinical Use.
Online Inquiry