Mouse Anti-TMEM220 Antibody (CBMOAB-60540FYA)


Cat: CBMOAB-60540FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-60540FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO60540FYA 100 µg
MO-AB-12919W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12919W 100 µg
MO-AB-29580H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29580C 100 µg
MO-AB-66467W Monoclonal Marmoset WB, ELISA MO66467W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO60540FYA
SpecificityThis antibody binds to Rhesus TMEM220.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus TMEM220 Antibody is a mouse antibody against TMEM220. It can be used for TMEM220 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTMEM220
UniProt IDF7AP14
Protein RefseqThe length of the protein is 160 amino acids long.
The sequence is show below: MAPSLWRACNGLMAAFFAMAAFVQVNDPDAELWVVVYTIPAVLTLLVGLNPQVTGNVIWKGISAIHILFCMVWAVGLAYYLLRHTQQNILHEEEGRELCGLVIITAWIILCRSSSKTPVGGRIQLAIAIVITLFPFISWVYIYINKEMRSSWPTHCKTVI.
For Research Use Only | Not For Clinical Use.
Online Inquiry