AibGenesis™ Mouse Anti-TMEM52B Antibody (CBMOAB-60600FYA)


Cat: CBMOAB-60600FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-60600FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO60600FYA 100 µg
MO-AB-21890R Monoclonal Cattle (Bos taurus) WB, ELISA MO21890R 100 µg
MO-AB-29618H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29618C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO60600FYA
SpecificityThis antibody binds to Rhesus TMEM52B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus TMEM52B Antibody is a mouse antibody against TMEM52B. It can be used for TMEM52B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTMEM52B
UniProt IDF6WML1
Protein RefseqThe length of the protein is 130 amino acids long.
The sequence is show below: LLVGIGALLLLCGLSSLCFRCCCLSRQQNGEDGGPPPYEVTVIAFDHDSTLQSTITSLQSVFGPAARRILAVAHSHSSLGQLPSSLDTLPGYEEALHMSRFTVARCGQKAPDLPPVPEEKQLPPIEKEST.
For Research Use Only | Not For Clinical Use.
Online Inquiry