AibGenesis™ Mouse Anti-TMEM8B Antibody (MO-AB-06608W)


Cat: MO-AB-06608W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-06608W Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO06608W 100 µg
MO-AB-20968W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20968W 100 µg
MO-AB-21915R Monoclonal Cattle (Bos taurus) WB, ELISA MO21915R 100 µg
MO-AB-66559W Monoclonal Marmoset WB, ELISA MO66559W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO06608W
SpecificityThis antibody binds to Rhesus TMEM8B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus TMEM8B Antibody is a mouse antibody against TMEM8B. It can be used for TMEM8B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTransmembrane protein 8B isoform b; TMEM8B
UniProt IDH9F254
Protein RefseqThe length of the protein is 75 amino acids long.
The sequence is show below: VYTFTMFFSTVCGCVCILSLGACEWWWVTVCISTTFSKGLGMYVPSLCLLQTETAVLPNLSCIEKGRFCKAHWRK.
For Research Use Only | Not For Clinical Use.
Online Inquiry