Mouse Anti-TNP1 Antibody (CBMOAB-60794FYA)
Cat: CBMOAB-60794FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-60794FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) | WB, ELISA | MO60794FYA | 100 µg | ||
| MO-AB-10278Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO10278Y | 100 µg | ||
| MO-AB-18030Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO18030Y | 100 µg | ||
| MO-AB-22005R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO22005R | 100 µg | ||
| MO-AB-24908W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO24908W | 100 µg | ||
| MO-AB-29680H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO29680C | 100 µg | ||
| MO-AB-33790W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO33790W | 100 µg | ||
| MO-AB-42722W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO42722W | 100 µg | ||
| MO-AB-46879W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO46879W | 100 µg | ||
| MO-AB-66651W | Monoclonal | Marmoset | WB, ELISA | MO66651W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) |
| Clone | MO60794FYA |
| Specificity | This antibody binds to Rhesus TNP1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Rhesus TNP1 Antibody is a mouse antibody against TNP1. It can be used for TNP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | TNP1 |
| UniProt ID | F6SQ53 |
| Protein Refseq | The length of the protein is 61 amino acids long. The sequence is show below: MMPIAITAPTCESSAGSALVHFTQHQAATRTAEGGLPRRTDVRSKPERSLWNVDQMPVVTK. |
For Research Use Only | Not For Clinical Use.
Online Inquiry