AibGenesis™ Mouse Anti-TPD52L2 Antibody (MO-AB-06668W)


Cat: MO-AB-06668W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-06668W Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO06668W 100 µg
MO-AB-08650H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08650C 100 µg
MO-AB-15298W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15298W 100 µg
MO-AB-22069R Monoclonal Cattle (Bos taurus) WB, ELISA MO22069R 100 µg
MO-AB-29717H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29717C 100 µg
MO-AB-66744W Monoclonal Marmoset WB, ELISA MO66744W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus)
CloneMO06668W
SpecificityThis antibody binds to Rhesus TPD52L2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the tumor protein D52-like family. These proteins are characterized by an N-terminal coiled-coil motif that is used to form homo- and heteromeric complexes with other tumor protein D52-like proteins. Expression of this gene may be a marker for breast cancer and acute lymphoblastic leukemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 12. (From NCBI)
Product OverviewMouse Anti-Rhesus TPD52L2 Antibody is a mouse antibody against TPD52L2. It can be used for TPD52L2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTumor protein D54 isoform c; TPD52L2
UniProt IDH9FZ56
Protein RefseqThe length of the protein is 220 amino acids long.
The sequence is show below: MDSAGQDINLNSPNKGLLSDSMTDVPVDTGVAARTPAIEGLTEAEEEELRAELTKVEEEIVTLRQVLAAKERHCGELKRRLGLSTLGGLKQNLSRSWHDVQVSNAYVKTSEKLGEWNEKVTQSDLYKKTQETLSQAGQKTSAALSTVGSAISRKLGDMSSYSIRHSISMPAMRNSATFKSFEDRVGTIKSKVVGDRENGSDNLPSSAGSGDKPLSDPAPF.
For Research Use Only | Not For Clinical Use.
Online Inquiry