Mouse Anti-TRAT1 Antibody (CBMOAB-61040FYA)


Cat: CBMOAB-61040FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-61040FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO61040FYA 100 µg
MO-AB-22133R Monoclonal Cattle (Bos taurus) WB, ELISA MO22133R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO61040FYA
SpecificityThis antibody binds to Rhesus TRAT1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus TRAT1 Antibody is a mouse antibody against TRAT1. It can be used for TRAT1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTRAT1
UniProt IDF7HKL9
Protein RefseqThe length of the protein is 187 amino acids long.
The sequence is show below: FPGNSGCPFFLWGLLALLGLALVISLIFNISHYVEKQRQDKMYSYSNDHIPRDDEYYIEDAPIYGNLDDMISEPMDENCYEQMKARPEKSVNERHEATPSAQATNETQMCYASLDHSIKGKRRKPRKQNSHFSDKDGHEQLHAIDASVSKTTLVDSFSPESQAVEENIHDDPIRLFGLIRAKREPIN.
For Research Use Only | Not For Clinical Use.
Online Inquiry