Mouse Anti-USP35 Antibody (CBMOAB-61961FYA)


Cat: CBMOAB-61961FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-61961FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Guinea pig (Cavia porcellus), Mallard (Anas platyrhynchos), Marmoset, Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries) WB, ELISA MO61961FYA 100 µg
MO-AB-01637L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO01637L 100 µg
MO-AB-09720W Monoclonal Cat (Felis catus) WB, ELISA MO09720W 100 µg
MO-AB-10434Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO10434Y 100 µg
MO-AB-18179Y Monoclonal Sheep (Ovis aries) WB, ELISA MO18179Y 100 µg
MO-AB-22693R Monoclonal Cattle (Bos taurus) WB, ELISA MO22693R 100 µg
MO-AB-23874H Monoclonal Mallard (Anas platyrhynchos) WB, ELISA MO23874C 100 µg
MO-AB-33984W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO33984W 100 µg
MO-AB-35953W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35953W 100 µg
MO-AB-42824W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO42824W 100 µg
MO-AB-67525W Monoclonal Marmoset WB, ELISA MO67525W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Guinea pig (Cavia porcellus), Mallard (Anas platyrhynchos), Marmoset, Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries)
CloneMO61961FYA
SpecificityThis antibody binds to Rhesus USP35.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the peptidase C19 family of ubiquitin-specific proteases. These deubiquitinating enzymes (DUBs) catalyze the removal of ubiquitin proteins from other proteins. The encoded protein associates with polarized mitochondria and has been shown to inhibit NF-kappa B activation and delay PARK2-mediated degradation of mitochondria. Expression of this gene is upregulated by the let-7a microRNA and reduced expression has been observed in human tumor tissues. (From NCBI)
Product OverviewMouse Anti-Rhesus USP35 Antibody is a mouse antibody against USP35. It can be used for USP35 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesUbiquitin carboxyl-terminal hydrolase 35; USP35
UniProt IDH9FGV5
Protein RefseqThe length of the protein is 76 amino acids long.
The sequence is show below: LLFCQQLVRCLGRFRCPAEGEEGAVEFLEQAQQVSGLLAQLWRAQPAAILPCLKELFAVISCTEEEPPSSALASVG.
For Research Use Only | Not For Clinical Use.
Online Inquiry