AibGenesis™ Mouse Anti-VMAC Antibody (CBMOAB-62103FYA)


Cat: CBMOAB-62103FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-62103FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO62103FYA 100 µg
MO-AB-22795R Monoclonal Cattle (Bos taurus) WB, ELISA MO22795R 100 µg
MO-AB-23225W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23225W 100 µg
MO-AB-29982H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29982C 100 µg
MO-AB-67676W Monoclonal Marmoset WB, ELISA MO67676W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO62103FYA
SpecificityThis antibody binds to Rhesus VMAC.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus VMAC Antibody is a mouse antibody against VMAC. It can be used for VMAC detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesVimentin-type intermediate filament-associated coiled-coil protein; VMAC
UniProt IDH9FUC9
Protein RefseqThe length of the protein is 169 amino acids long.
The sequence is show below: MSAPPALQIREANAHLAAVHRRAAELEARLDAAERTVHAQAERLALHDQQLRAALDELGRAKDREIATLQEQMMTSEATVHSLQAAVHQRDKLIRQLQPRAELLQDICRRRPPLAGLLAALTEAERLGPVPASDLGHPPPGGPGPPLANSTGEEVDRDPLQPAVFGTTV.
For Research Use Only | Not For Clinical Use.
Online Inquiry