AibGenesis™ Mouse Anti-WDR49 Antibody (CBMOAB-62307FYA)


Cat: CBMOAB-62307FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-62307FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO62307FYA 100 µg
MO-AB-06922W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO06922W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO62307FYA
SpecificityThis antibody binds to Rhesus WDR49.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the WD repeat protein family with nine WD repeats. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. Alternative splicing results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Rhesus WDR49 Antibody is a mouse antibody against WDR49. It can be used for WDR49 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesWD repeat-containing protein 49; WDR49
UniProt IDH9FD95
Protein RefseqThe length of the protein is 120 amino acids long.
The sequence is show below: KLDTKPQKLLSAGRSHSTHPVADQSTMGVRNFEIDTEGKNAVMRLCFLKVRKNTAVTGGANLVSCGGSGYVRFWDIYKKQLLAEFLAHSGAGTIIMSTDKMNRYLTTGDLDGWLKIWNIE.
For Research Use Only | Not For Clinical Use.
Online Inquiry