AibGenesis™ Mouse Anti-WDR53 Antibody (CBMOAB-62310FYA)


Cat: CBMOAB-62310FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-62310FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset WB, ELISA MO62310FYA 100 µg
MO-AB-09123H Monoclonal Frog (Xenopus laevis) WB, ELISA MO09123C 100 µg
MO-AB-14285W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14285W 100 µg
MO-AB-22935R Monoclonal Cattle (Bos taurus) WB, ELISA MO22935R 100 µg
MO-AB-67840W Monoclonal Marmoset WB, ELISA MO67840W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset
CloneMO62310FYA
SpecificityThis antibody binds to Rhesus WDR53.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein containing WD domains. The function of this gene is unknown. (From NCBI)
Product OverviewMouse Anti-Rhesus WDR53 Antibody is a mouse antibody against WDR53. It can be used for WDR53 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesWD repeat-containing protein 53; WDR53
UniProt IDH9EZR1
Protein RefseqThe length of the protein is 344 amino acids long.
The sequence is show below: MAVKWTGGHSSPVLCLNASKEGLLASGAEGGDLTAWGEDGTPLGHMRFQGADDVTSVLFSPSCPTKLYASHGETISVLDVRSLKDSLDHFHMNEEEINCLSLNQTENLLASADDSGAIKILDVENKKVVRSLKRHSNICSSVAFRPQRPQSLVSCGLDMQVMLWSLQKARPLWITNLQEDETEEMEGPQSPGQLLNPALAHCISVASCGNIFSCGAEDGKVRIFRVMGVKCEQELGFKGHTLGVSQVCFLPESYLLLTGGNDGKIMLWDANSEVEKKQKSPTKRTHRKKPKRGTCTKQGGNTDASVTDEEEHGNILPKLNIEHGEKVNWLLGTKIKGHQNILVA.
For Research Use Only | Not For Clinical Use.
Online Inquiry