AibGenesis™ Mouse Anti-WDR85 Antibody (CBMOAB-62336FYA)
Cat: CBMOAB-62336FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-62336FYA | Monoclonal | Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset | WB, ELISA | MO62336FYA | 100 µg | ||
| MO-AB-20539W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO20539W | 100 µg | ||
| MO-AB-67867W | Monoclonal | Marmoset | WB, ELISA | MO67867W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset |
| Clone | MO62336FYA |
| Specificity | This antibody binds to Rhesus WDR85. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Rhesus WDR85 Antibody is a mouse antibody against WDR85. It can be used for WDR85 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | WD repeat-containing protein 85; WDR85 |
| UniProt ID | H9EYU0 |
| Protein Refseq | The length of the protein is 37 amino acids long. The sequence is show below: MMGAFALQTVDTELTADSVEWCPLQGCRHLLACGTYQ. |
For Research Use Only | Not For Clinical Use.
Online Inquiry