Mouse Anti-XG Antibody (CBMOAB-62459FYA)


Cat: CBMOAB-62459FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-62459FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO62459FYA 100 µg
MO-AB-16865W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16865W 100 µg
MO-AB-67963W Monoclonal Marmoset WB, ELISA MO67963W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset
CloneMO62459FYA
SpecificityThis antibody binds to Rhesus XG.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes the XG blood group antigen, and is located at the pseudoautosomal boundary on the short (p) arm of chromosome X. The three 5' exons reside in the pseudoautosomal region and the remaining exons within the X-specific end. A truncated copy of this gene is found on the Y chromosome at the pseudoautosomal boundary. It is transcribed, but not expected to make a Y-chromosome specific gene product. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus XG Antibody is a mouse antibody against XG. It can be used for XG detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesXG
UniProt IDF6ZS50
Protein RefseqThe length of the protein is 193 amino acids long.
The sequence is show below: MESWWGLPCLAFLCFLMHARGQRDFDLADALDDPEPTKKPNSDIYPKPKPPSYPQPENPNSGGNIYPRPKPHPQPQPGNPGNSGGYFNDVDRDDGRYPPRPRPPAGGGGGGYSSYDNSGNTHGRRGYRPNSRYGNTYGGDHHSTYGNPEGNMVAKIVSPIVSVVVVTLLGAAASYFKLNNGRNCFRTREPENV.
For Research Use Only | Not For Clinical Use.
Online Inquiry