AibGenesis™ Mouse Anti-YIPF7 Antibody (CBMOAB-62553FYA)


Cat: CBMOAB-62553FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-62553FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Dog (Canis lupus familiaris), Rabbit (Oryctolagus cuniculus) WB, ELISA MO62553FYA 100 µg
MO-AB-10530Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO10530Y 100 µg
MO-AB-23060R Monoclonal Cattle (Bos taurus) WB, ELISA MO23060R 100 µg
MO-AB-34099W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO34099W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Dog (Canis lupus familiaris), Rabbit (Oryctolagus cuniculus)
CloneMO62553FYA
SpecificityThis antibody binds to Rhesus YIPF7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus YIPF7 Antibody is a mouse antibody against YIPF7. It can be used for YIPF7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein YIPF7; YIPF7
UniProt IDH9FDN9
Protein RefseqThe length of the protein is 123 amino acids long.
The sequence is show below: TIDNQEHSGDDSNAYGNLYGSRKQQAGEQPQPASFVPSETLMSPGYAGQFFQPASNSDYYSQSPYIDSFDEEPPLLEELGIHFDHIWQKTWTVLNPMKPADGSIMNETDLTGPILFCIALGAT.
For Research Use Only | Not For Clinical Use.
Online Inquiry