AibGenesis™ Mouse Anti-ZFAND5 Antibody (CBMOAB-62808FYA)


Cat: CBMOAB-62808FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-62808FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Sheep (Ovis aries) WB, ELISA MO62808FYA 100 µg
MO-AB-09480H Monoclonal Frog (Xenopus laevis) WB, ELISA MO09480C 100 µg
MO-AB-13161W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13161W 100 µg
MO-AB-18332Y Monoclonal Sheep (Ovis aries) WB, ELISA MO18332Y 100 µg
MO-AB-23178R Monoclonal Cattle (Bos taurus) WB, ELISA MO23178R 100 µg
MO-AB-30096H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO30096C 100 µg
MO-AB-31332R Monoclonal Pig (Sus scrofa) WB, ELISA MO31332R 100 µg
MO-AB-68224W Monoclonal Marmoset WB, ELISA MO68224W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Sheep (Ovis aries)
CloneMO62808FYA
SpecificityThis antibody binds to Rhesus ZFAND5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ZFAND5 Antibody is a mouse antibody against ZFAND5. It can be used for ZFAND5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZFAND5
UniProt IDF7CWU6
Protein RefseqThe length of the protein is 210 amino acids long.
The sequence is show below: AKPEQAADGGVRGRGTRPPAQEAQRRRRRSVVVARGLAPGVPGSLHSTQKNMAQETNQTPGPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQQNSGRMSPMGTASGSNSPTSDSASVQRADTSLNNCEGAAGSTSEKSRNVPVAALPVTQQMTEMSISREDKITTPKTEVSEPVVTQPSPSVSQPSTSQSEEKAPELPKPKKNRCFMCRK.
For Research Use Only | Not For Clinical Use.
Online Inquiry