AibGenesis™ Mouse Anti-ZKSCAN5 Antibody (CBMOAB-62886FYA)


Cat: CBMOAB-62886FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-62886FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO62886FYA 100 µg
MO-AB-18833W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18833W 100 µg
MO-AB-68299W Monoclonal Marmoset WB, ELISA MO68299W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset
CloneMO62886FYA
SpecificityThis antibody binds to Rhesus ZKSCAN5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a zinc finger protein of the Kruppel family. The protein contains a SCAN box and a KRAB A domain and may be involved in transcriptional regulation. A similar protein in mouse is differentially expressed in spermatogenesis. Alternative splicing results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Rhesus ZKSCAN5 Antibody is a mouse antibody against ZKSCAN5. It can be used for ZKSCAN5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZinc finger protein with KRAB and SCAN domains 5; ZKSCAN5
UniProt IDJ7M2L5
Protein RefseqThe length of the protein is 188 amino acids long.
The sequence is show below: PWVREHHPESGEEAVAVIEDIQRELEERRQQIVACPDGLPQKMAPPGAVQESCSLQPLTVDTQPEQAPQKPHLLEENAFPVLQVPSLPLKDSQELTASLLSTGSQKLVKIEEVADVAVSFILEEWGHLDQSQKSLYRDDRKENYGSITSMGYESRDNMELIVKQISDDAESHWVAPEHTERSVPQDPD.
For Research Use Only | Not For Clinical Use.
Online Inquiry