AibGenesis™ Mouse Anti-ZNF10 Antibody (CBMOAB-62929FYA)


Cat: CBMOAB-62929FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-62929FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes) WB, ELISA MO62929FYA 100 µg
MO-AB-14614W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14614W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes)
CloneMO62929FYA
SpecificityThis antibody binds to Rhesus ZNF10.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene contains a C2H2 zinc finger, and has been shown to function as a transcriptional repressor. The Kruppel-associated box (KRAB) domain of this protein is found to be responsible for its transcriptional repression activity. RING finger containing protein TIF1 was reported to interact with the KRAB domain, and may serve as a mediator for the repression activity of this protein. (From NCBI)
Product OverviewMouse Anti-Rhesus ZNF10 Antibody is a mouse antibody against ZNF10. It can be used for ZNF10 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZinc finger protein 10; ZNF10
UniProt IDH9EW21
Protein RefseqThe length of the protein is 573 amino acids long.
The sequence is show below: MHAKSLTAWSQTLVTFKDVFVDFTREEWKLLDTAQQIVYRNVMLENYKNLVSLGYQLTKPDVILRLEKGEEPWLVERGIHQEAHPDSETAFELKSSVSSRSIFKDKQSCDIKMEGMARNDLWYLSLEEVWKCKDQLDKYQENPERHLRQVAFTQKKVLTQKRVSESGKYGGNCLLPAQLVLREYFHKRDSHTKSLKHDLVLNGHQESCASNSNECGQTFCQNIHLIQFARTHTGDKSYKCPDNDNSLTHDSSLGISKGIHNKKPYECKECGKFFSWRSNLTRHQLIHTGEKPYECKECGKSFSRSSHLIGHQKTHTGEEPYECKECGKSFSWFSHLVTHQRTHTGDKLYTCNQCGKSFVHSSRLIRHQRTHTGEKPYECPECGKSFRQSTHLILHQRTHVRVRPYECNECGKSYSQRSHLVVHHRIHTGLKPFECKDCGKCFSRSSHLYSHQRTHTGEKPYECHDCGKSFSQSSALIVHQRIHTGEKPYECCQCGKAFIRKNDLIKHQRIHIGEETYKCNQCGIIFSQNSPFIVHQIAHTGEQFLTCNQCGTVLVNTSNLIGYQANHMRENAY.
For Research Use Only | Not For Clinical Use.
Online Inquiry