Mouse Anti-ZNF267 Antibody (CBMOAB-63088FYA)


Cat: CBMOAB-63088FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-63088FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes) WB, ELISA MO63088FYA 100 µg
MO-AB-17937W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17937W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes)
CloneMO63088FYA
SpecificityThis antibody binds to Rhesus ZNF267.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ZNF267 Antibody is a mouse antibody against ZNF267. It can be used for ZNF267 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZinc finger protein 267; ZNF267
UniProt IDH9FDW1
Protein RefseqThe length of the protein is 404 amino acids long.
The sequence is show below: GLLIFRDVAIEFSPEEWSYLDPAQQNLYRDVMLENYRNLVSLGLLVSKPDLITFLEQRKEPWNVKREETVAVQPDVFSHYNKDLLTEQCTEASFQKVVSRRHGNCHLENLHLRKRWKREECDGHNGCYDEKTFKYDQFDESSVESLFHQQILSSCAKSYNFDQYRKVFTHSSLFNQQEEIDIWGKHHIHDKTSELFRQVSTLSRYRDVFIGEKNYHCNNSEKTLNQSSSPKNHQENCFLEKQCKCKEFEKVFLQSMHGQEKQEQSYKCNKCVEVCAQSLKHIQHQTIHIRENSYRCNKYDKDLSQSSNLRKQIIHNEEKPYKCEKCGDSFNHSLHLTQHQIIPTEEKPYKWKECGKVFNLNCSLYLTKQQQIDTGENLYKCKACSKSFTRSSNLIVHQRIHTGE.
For Research Use Only | Not For Clinical Use.
Online Inquiry