AibGenesis™ Mouse Anti-ZNF324 Antibody (CBMOAB-63146FYA)


Cat: CBMOAB-63146FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-63146FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO63146FYA 100 µg
MO-AB-07132W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO07132W 100 µg
MO-AB-11917W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11917W 100 µg
MO-AB-68431W Monoclonal Marmoset WB, ELISA MO68431W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset
CloneMO63146FYA
SpecificityThis antibody binds to Rhesus ZNF324.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ZNF324 Antibody is a mouse antibody against ZNF324. It can be used for ZNF324 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZinc finger protein 324A; ZNF324
UniProt IDI2CVL2
Protein RefseqThe length of the protein is 553 amino acids long.
The sequence is show below: MAFEDVAVYFSQEEWGLLDTAQRALYRRVMLDNFALVASLGLSTSRPRVVIQLERGEEPWVPSGTDTILSRNTYRRRNPGSWSVAEDGDVSGEWPRAFPDTPPGMTTSIFPVAGACHSVKSLQRQRGASPSRERKPTGVSVIYWERLLLGSGSGQASVSLRLTSPLRPPEGGQLREKTLTEHPVPGRRPRTPERQKPCAQEVPGRAFGNAPDLEATSGRGHHGMGPTWQEPQRLLGGQEPSTWGELGEALPAGEKSFECRACSKVFVKSSDLLKHLRTHTGERPYECAQCGKAFSQTSHLTQHQRIHSGETPYACPVCGKAFRHSSSLVRHQRIHTAEKSFSCSECGKAFSHGSNLSQHRKIHAGGRPYACAQCGRRFCRNSHLIQHERTHTGEKPFVCALCGAAFSQGSSLFKHQRVHTGEKPFACPQCGRAFSHSSNLTQHQLLHTGERPFRCGDCGKAFAKGAVLLSHRRIHTGEKPFVCTQCGRAFRERPALFHHQRIHTGEKPVRRSRASLHPQARSVSATSSEGAPGKETEPTSASGPAAVSEPGEV.
For Research Use Only | Not For Clinical Use.
Online Inquiry